Product details
| Product Overview | Recombinant Human p53 (Gly108~Lys370) active protein was expressed in E.coli with N-terminal His-tag. |
| Source | E.coli |
| Species | Human |
| Tag | N-terminal His-tag |
| Form | Liquid |
| Bio-activity | Active protein |
| Length | Partial, Human p53 (Gly108~Lys370) |
| AA Sequence | GFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALEL |
| Molecular Mass | 34kDa as determined by SDS-PAGE reducingconditions |
| Purity | >90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU per ug protein as determined by the LAL method. |
| Applications | Cell culture; Activity Assays. |
| Buffer | PBS, pH7.4, containing 0.01% SKL, 5% Trehalose |
| Reconstitution | Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex. |
| Storage | Store at 2-8℃ for 1 month. It is recommended that the protein be aliquoted and store at -80℃ for 12 months.Avoid repeated freeze/thaw cycles. |
| Synonyms | TP53; LFS1; TRP53; Li-Fraumeni Syndrome; Cellular tumor antigen p53; Antigen NY-CO-13; Phosphoprotein p53; Tumor suppressor p53 |
| Gene ID | TP53 |
| UniProt ID | P04637 |